PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g26920.1.p
Common NameBRADI_1g26920, LOC100822177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 401aa    MW: 42344.6 Da    PI: 6.4309
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g26920.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.2e-181360148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l+++++ +G ++W++++++ g+ R++k+c++rw +yl
  Bradi1g26920.1.p 13 RGLWSPEEDEKLLRYITAHGQPCWSSVPKHAGLERCGKSCRLRWINYL 60
                      788*******************************************97 PP

2Myb_DNA-binding50.35.7e-1666109146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E+  ++d+++ lG++ W+ Ia++++ gRt++++k++w++
  Bradi1g26920.1.p  66 RGAFSEQEERTILDVHRILGNR-WAQIAKHLP-GRTDNEVKNFWNS 109
                       89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-26463IPR009057Homeodomain-like
PROSITE profilePS5129418.778860IPR017930Myb domain
SuperFamilySSF466891.06E-2710107IPR009057Homeodomain-like
SMARTSM007172.5E-141262IPR001005SANT/Myb domain
PfamPF002491.7E-151360IPR001005SANT/Myb domain
CDDcd001678.16E-121660No hitNo description
PROSITE profilePS5129425.48861115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2464116IPR009057Homeodomain-like
SMARTSM007172.5E-1565113IPR001005SANT/Myb domain
PfamPF002499.9E-1566109IPR001005SANT/Myb domain
CDDcd001671.97E-1168108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLLRYITA HGQPCWSSVP KHAGLERCGK SCRLRWINYL  60
RPDLKRGAFS EQEERTILDV HRILGNRWAQ IAKHLPGRTD NEVKNFWNSC IKKKLIAQGI  120
DPKTHNLLPA ASKNLLHGAG ANNNNNPASA AGQFQSSSNS NGSTTPFTIS SPTKAAVATV  180
APPAVSMAPA LYDYNNVVPN PGASSGMLMG HEHAAAAMQL QQQGVYPSYA DNGGGVLMNF  240
RDQNNHAASM SMSMSMDFMN ASSNSSSSME LAAGGMTNNP GMEGMAAFLD DEAAAMWATT  300
VEEGMSGPGM LLQQQQGLVQ DEVVVGPPLI GTSNGGGPVG NGNGNGKGAM DMMDVSSAVY  360
GGAAGATTTA FDLELMESCG MFYGGSAGTG MGMEQLQWDY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-33131157108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00350DAPTransfer from AT3G12720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560182.10.0PREDICTED: myb-related protein Hv33-like
TrEMBLI1GU760.0I1GU76_BRADI; Uncharacterized protein
STRINGBRADI1G26920.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97513545
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.15e-82myb domain protein 67